PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof015436
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 198aa    MW: 21676.4 Da    PI: 4.537
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-4040PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-15246248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g++++eE++  +  ++qlG++ W++Ia++++ gRt++++k+ w+++l
        Sof015436  2 GNFSKEEEDAVISFHEQLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 46
                     79*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.3E-10148IPR001005SANT/Myb domain
PROSITE profilePS5129422.125150IPR017930Myb domain
PfamPF002497.5E-14246IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-12251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-22247IPR009057Homeodomain-like
CDDcd001679.97E-12346No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
XGNFSKEEED AVISFHEQLG NRWSAIAAKL PGRTDNEIKN VWHTHLKKRL EPTNKPEQRG  60
AQAAGAGKKH RPKRGGAKKT TAPATTAPVS PERSAASSSV TESSSMMEQE QEQEQGNTGN  120
SPGFPKEESF TSSSDAEEFQ FDDTFWSETL SMPLESFDVP MEPSDALGAS SVGADGDLDY  180
WLRVFMESGD VHQELPQI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.110760.0bud| callus| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448188.11e-112hypothetical protein SORBIDRAFT_06g022660
SwissprotQ7XBH43e-56MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLC5YCC81e-111C5YCC8_SORBI; Putative uncharacterized protein Sb06g022660
STRINGSb06g022660.11e-111(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.25e-28myb domain protein 15